Lineage for d1dcnc_ (1dcn C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51054Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 51055Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 51056Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 51070Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 51071Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (4 PDB entries)
  8. 51080Domain d1dcnc_: 1dcn C: [19422]

Details for d1dcnc_

PDB Entry: 1dcn (more details), 2.3 Å

PDB Description: inactive mutant h162n of delta 2 crystallin with bound argininosuccinate

SCOP Domain Sequences for d1dcnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcnc_ a.127.1.1 (C:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
tdpimaklnssiaydqrlsevdiqgsmayakalekagiltktelakilsglekiseewsk
gvfvvkgsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdapdslelirsksgrvfgrlasilmvlkglpstynkdlqedk
eavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqaht
asgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalggtakssvt
tqieqlrelmkkqk

SCOP Domain Coordinates for d1dcnc_:

Click to download the PDB-style file with coordinates for d1dcnc_.
(The format of our PDB-style files is described here.)

Timeline for d1dcnc_: