Lineage for d1dcnc_ (1dcn C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins)
  6. Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (10 PDB entries)
    Uniprot P24058 P24057
  8. Domain d1dcnc_: 1dcn C: [19422]
    complexed with as1; mutant

Details for d1dcnc_

PDB Entry: 1dcn (more details), 2.3 Å

PDB Description: inactive mutant h162n of delta 2 crystallin with bound argininosuccinate
PDB Compounds: (C:) delta 2 crystallin

SCOPe Domain Sequences for d1dcnc_:

Sequence, based on SEQRES records: (download)

>d1dcnc_ a.127.1.1 (C:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirsksgrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveq
ytalagtakssvttqieqlrelmkkqk

Sequence, based on observed residues (ATOM records): (download)

>d1dcnc_ a.127.1.1 (C:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdapdslelirsksgrvfgrlasilmvlkglpstynkdlqedk
eavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqaht
asgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalagtakssvt
tqieqlrelmkkqk

SCOPe Domain Coordinates for d1dcnc_ are not available.

Timeline for d1dcnc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dcna_, d1dcnb_, d1dcnd_