![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (9 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:282458] [194218] (1 PDB entry) |
![]() | Domain d4fn6b_: 4fn6 B: [194219] automated match to d3no6b_ complexed with act, gol |
PDB Entry: 4fn6 (more details), 2.69 Å
SCOPe Domain Sequences for d4fn6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fn6b_ a.132.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]} mefsqklyqaakpiindiyeddfiqkmllgniqadalrhylqadaaylkeftnlyallip kmnsmndvkflveqiefmvegevlahdilaqivgesyeeiiktkvwppsgdhyikhmyfq ahsrenaiytiaamapcpyiyaelakrsqsdhklnrekdtakwfdfystemddiinvfes lmnklaesmsdkeleqvkqvflesciherrffnmamtleqwefgg
Timeline for d4fn6b_: