Lineage for d4gvia_ (4gvi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084171Species Salmonella enterica [TaxId:99287] [194211] (5 PDB entries)
  8. 2084176Domain d4gvia_: 4gvi A: [194216]
    automated match to d2oxna_
    complexed with ah0, mes, nag; mutant

Details for d4gvia_

PDB Entry: 4gvi (more details), 1.55 Å

PDB Description: Crystal structure of mutant (D248N) Salmonella typhimurium family 3 glycoside hydrolase (NagZ) in complex with GlcNAc-1,6-anhMurNAc
PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d4gvia_:

Sequence, based on SEQRES records: (download)

>d4gvia_ c.1.8.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
fdgvifsndlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekag

Sequence, based on observed residues (ATOM records): (download)

>d4gvia_ c.1.8.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
fdgvifsndlsmsyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkg
sfsrrelmdsarwktasaqlnqlherwqeekag

SCOPe Domain Coordinates for d4gvia_:

Click to download the PDB-style file with coordinates for d4gvia_.
(The format of our PDB-style files is described here.)

Timeline for d4gvia_: