Lineage for d4gvhb_ (4gvh B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419426Species Salmonella enterica [TaxId:99287] [194211] (5 PDB entries)
  8. 2419430Domain d4gvhb_: 4gvh B: [194212]
    automated match to d2oxna_
    complexed with 0xy, mes

Details for d4gvhb_

PDB Entry: 4gvh (more details), 1.45 Å

PDB Description: Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc.
PDB Compounds: (B:) Beta-hexosaminidase

SCOPe Domain Sequences for d4gvhb_:

Sequence, based on SEQRES records: (download)

>d4gvhb_ c.1.8.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekagh

Sequence, based on observed residues (ATOM records): (download)

>d4gvhb_ c.1.8.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtetpcdprp
etdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelgfdgvi
fsddlssyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkgsfsrre
lmdsarwktasaqlnqlherwqeekagh

SCOPe Domain Coordinates for d4gvhb_:

Click to download the PDB-style file with coordinates for d4gvhb_.
(The format of our PDB-style files is described here.)

Timeline for d4gvhb_: