Lineage for d4hz7a_ (4hz7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082987Species Uncultured bacterium [TaxId:77133] [188736] (6 PDB entries)
  8. 2082992Domain d4hz7a_: 4hz7 A: [194207]
    automated match to d3fiya_
    complexed with bgc

Details for d4hz7a_

PDB Entry: 4hz7 (more details), 2 Å

PDB Description: Crystal structure of BglB with glucose
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d4hz7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hz7a_ c.1.8.4 (A:) Beta-glucosidase A {Uncultured bacterium [TaxId: 77133]}
kkfpegflwgaatssyqiegawnedgkgesiwdrftripgkikngdsgdvacdhyhryeq
dldlmrqlglktyrfsiawariqpdssrqinqrgldfyrrlveglhkrdilpmatlyhwd
lpqwvedeggwlsresasrfaeythalvaalgdqiplwvthnepmvtvwagyhmglfapg
lkdptlggrvahhlllshgqalqafralspagsqmgitlnfntiypvsaepadveaarrm
hsfqnelfleplirgqynqatlmaypnlpefiapedmqtisapidflgvnyynpmrvkss
pqppgievvqvespvtamgweiapeglydllmgitrtygklpiyitengaafddqpdqsg
qvndpqrvgyfqghigaarraladgvdlrgyyawslldnfewaegyskrfgiiyvdfetq
qrtlkqsaqwyrdvianngle

SCOPe Domain Coordinates for d4hz7a_:

Click to download the PDB-style file with coordinates for d4hz7a_.
(The format of our PDB-style files is described here.)

Timeline for d4hz7a_: