Lineage for d3v6cb1 (3v6c B:-2-74)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931628Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2931755Domain d3v6cb1: 3v6c B:-2-74 [194204]
    Other proteins in same PDB: d3v6ca_, d3v6cb2
    automated match to d2c7nb1
    complexed with cl, gol, zn

Details for d3v6cb1

PDB Entry: 3v6c (more details), 1.7 Å

PDB Description: crystal structure of usp2 in complex with mutated ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d3v6cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v6cb1 d.15.1.1 (B:-2-74) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
rgsmqifvntltgthitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls
dyniqkestlhlvlrlr

SCOPe Domain Coordinates for d3v6cb1:

Click to download the PDB-style file with coordinates for d3v6cb1.
(The format of our PDB-style files is described here.)

Timeline for d3v6cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v6cb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3v6ca_