Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d3v6cb1: 3v6c B:-2-74 [194204] Other proteins in same PDB: d3v6ca_, d3v6cb2 automated match to d2c7nb1 complexed with cl, gol, zn |
PDB Entry: 3v6c (more details), 1.7 Å
SCOPe Domain Sequences for d3v6cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v6cb1 d.15.1.1 (B:-2-74) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} rgsmqifvntltgthitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtls dyniqkestlhlvlrlr
Timeline for d3v6cb1: