SCOPe 2.07: Domain d3v66a_: 3v66 A:

Lineage for d3v66a_ (3v66 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.2: Squalene synthase [48580] (2 protein domains)
   automatically mapped to Pfam PF00494

6. Protein automated matches [191305] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)

8. Domain d3v66a_: 3v66 A: [194203]
   automated match to d1ezfb_
   complexed with d3a, po4

Details for d3v66a_

PDB Entry: 3v66, 1.8 Å

PDB Description: human squalene synthase in complex with 2-(1-{2-[(4r,6s)-8-chloro-6-(2,3-dimethoxyphenyl)-4h,6h-pyrrolo[1,2-a][4,1]benzoxazepin-4-yl]acetyl}-4-piperidinyl)acetic acid

PDB Compounds: (A:) Squalene synthase

SCOPe Domain Sequences for d3v66a_:

Sequence; same for both SEQRES and ATOM records:

>d3v66a_ a.128.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvp
llhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigma
efldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktn
iirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvit
ylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavk
aiiyqymeeiyhripdsdpsssktrqiistirtqn

Timeline for d3v66a_:

• d3v66a_ first appeared in SCOPe 2.02
  
• d3v66a_ appears in SCOPe 2.06