SCOPe 2.05: Domain d3zcya_: 3zcy A:

Lineage for d3zcya_ (3zcy A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (9 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)

8. Domain d3zcya_: 3zcy A: [194198]
   automated match to d2ghex_
   complexed with epe, hem, k, so4; mutant

Details for d3zcya_

PDB Entry: 3zcy, 2 Å

PDB Description: Ascorbate peroxidase W41A-H42Y mutant

PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d3zcya_:

Sequence; same for both SEQRES and ATOM records:

>d3zcya_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaaysagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

Timeline for d3zcya_:

• d3zcya_ first appeared in SCOPe 2.02
  
• d3zcya_ appears in SCOPe 2.04
  
• d3zcya_ appears in SCOPe 2.06
  
• d3zcya_ appears in the current release, SCOPe 2.08