Lineage for d3zcya_ (3zcy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720315Protein automated matches [190089] (9 species)
    not a true protein
  7. 2720367Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)
  8. 2720376Domain d3zcya_: 3zcy A: [194198]
    automated match to d2ghex_
    complexed with epe, hem, k, so4; mutant

Details for d3zcya_

PDB Entry: 3zcy (more details), 2 Å

PDB Description: Ascorbate peroxidase W41A-H42Y mutant
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d3zcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zcya_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaaysagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d3zcya_:

Click to download the PDB-style file with coordinates for d3zcya_.
(The format of our PDB-style files is described here.)

Timeline for d3zcya_: