SCOPe 2.05: Domain d4agka_: 4agk A:

Lineage for d4agka_ (4agk A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (4 species)
   not a true protein

7. Species Aura virus [TaxId:44158] [194195] (3 PDB entries)

8. Domain d4agka_: 4agk A: [194197]
   automated match to d1kxfa_

Details for d4agka_

PDB Entry: 4agk, 1.81 Å

PDB Description: Crystal structure of capsid protein (110-267) from Aura virus

PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d4agka_:

Sequence; same for both SEQRES and ATOM records:

>d4agka_ b.47.1.3 (A:) automated matches {Aura virus [TaxId: 44158]}
drtfavknedgkimgyavamegkvikplhvkgtidhpalaklkftksssydmefaklpte
mksdafgyttehpegfynwhhgavqfsggrftiptgaggpgdsgrpildnsgkvvaivlg
ganegartalsvvtwnkkgaaiktthedtvew

Timeline for d4agka_:

• d4agka_ first appeared in SCOPe 2.02
  
• d4agka_ appears in SCOPe 2.04
  
• d4agka_ appears in SCOPe 2.06
  
• d4agka_ appears in the current release, SCOPe 2.08