SCOPe 2.05: Domain d4exza_: 4exz A:

Lineage for d4exza_ (4exz A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (24 PDB entries)

8. Domain d4exza_: 4exz A: [194187]
   automated match to d2rcta_
   complexed with act, ret; mutant

Details for d4exza_

PDB Entry: 4exz, 1.61 Å

PDB Description: Crystal Structure of the Q108K:K40L Mutant of Cellular Retinol Binding Protein Type II in Complex with All-trans-Retinal at 1.7 Angstrom Resolution

PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d4exza_:

Sequence; same for both SEQRES and ATOM records:

>d4exza_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegnklylelt
cgdqvcrqvfkkk

Timeline for d4exza_:

• d4exza_ first appeared in SCOPe 2.02
  
• d4exza_ appears in SCOPe 2.04
  
• d4exza_ appears in SCOPe 2.06
  
• d4exza_ appears in the current release, SCOPe 2.08