Lineage for d3uxib_ (3uxi B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088857Family c.1.15.2: L-rhamnose isomerase [51662] (2 protein domains)
    automatically mapped to Pfam PF06134
  6. 2088872Protein automated matches [191202] (1 species)
    not a true protein
  7. 2088873Species Bacillus halodurans [TaxId:86665] [189527] (4 PDB entries)
  8. 2088887Domain d3uxib_: 3uxi B: [194181]
    automated match to d3p14b_
    complexed with mn; mutant

Details for d3uxib_

PDB Entry: 3uxi (more details), 2.73 Å

PDB Description: Crystal structure of L-rhamnose isomerase W38A mutant from Bacillus halodurans
PDB Compounds: (B:) l-rhamnose isomerase

SCOPe Domain Sequences for d3uxib_:

Sequence, based on SEQRES records: (download)

>d3uxib_ c.1.15.2 (B:) automated matches {Bacillus halodurans [TaxId: 86665]}
sqferakieygqwgidveealerlkqvpisihcaqgddvggfelskgelsggidvtgdyp
gkattpeelrmdlekalslipgkhrvnlhaiyaetdgkvverdqleprhfekwvrwakrh
glgldfnptlfshekakdgltlahpdqairqfwidhciasrkigeyfgkeletpcltniw
ipdgykdtpsdrltprkrlkesldqifaaeineaynldavesklfgigsesyvvgshefy
lsyalkndklclldtghyhptetvsnkisamllfhdklalhvsrpvrwdsdhvvtfddel
reialeivrndaldrvligldffdasinriaawtigtrnvikallfamliphkqlkewqe
tgdytrrlavleefktyplgaiwneycermnvpikeewlkeiaiyekevllqr

Sequence, based on observed residues (ATOM records): (download)

>d3uxib_ c.1.15.2 (B:) automated matches {Bacillus halodurans [TaxId: 86665]}
sqferakieygqwgidveealerlkqvpisihcaqgddvggfelsgdypgkattpeelrm
dlekalslipgkhrvnlhaiyaetdgkvverdqleprhfekwvrwakrhglgldfnptlf
shekakdgltlahpdqairqfwidhciasrkigeyfgkeletpcltniwipdgykdtpsd
rltprkrlkesldqifaaeineaynldavesklfgigsesyvvgshefylsyalkndklc
lldtghyhptetvsnkisamllfhdklalhvsrpvrwdsdhvvtfddelreialeivrnd
aldrvligldffdasinriaawtigtrnvikallfamliphkqlkewqetgdytrrlavl
eefktyplgaiwneycermnvpikeewlkeiaiyekevllqr

SCOPe Domain Coordinates for d3uxib_:

Click to download the PDB-style file with coordinates for d3uxib_.
(The format of our PDB-style files is described here.)

Timeline for d3uxib_: