Lineage for d3vmla1 (3vml A:2-363)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906093Species Shewanella oneidensis [TaxId:211586] [194175] (12 PDB entries)
  8. 2906095Domain d3vmla1: 3vml A:2-363 [194176]
    Other proteins in same PDB: d3vmla2
    automated match to d1cnza_
    complexed with cl, ipm, mg

Details for d3vmla1

PDB Entry: 3vml (more details), 1.56 Å

PDB Description: chimera 3-isopropylmalate dehydrogenase between shewanella oneidensis mr-1 (o) and shewanella benthica db21 mt-2 (m) from n-terminal: 20% o middle 70% m residual 10% o
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3vmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vmla1 c.77.1.1 (A:2-363) automated matches {Shewanella oneidensis [TaxId: 211586]}
syqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaidnhgcplpeatlk
gceaadavlfgsvggpkwehlppndqpergallplrghfelfcnmrpaklhpglehmspl
rsdisekgfdilcvreltggiyfgkpkgrqgegeneeafdtmrysrkeirriakiafesa
qgrrkkvtsvdkanvlacsvlwrevveevakdypdvelehiyidnatmqllrrpnefdvm
lcsnlfgdivsdeiamltgsmgllasismnsqgfgmyepaggsapdiagqgianpvaqil
saalllrhslkledaalaieaavskalnsgyltgellssdqrhkakttvqmgdfiadavk
ag

SCOPe Domain Coordinates for d3vmla1:

Click to download the PDB-style file with coordinates for d3vmla1.
(The format of our PDB-style files is described here.)

Timeline for d3vmla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vmla2