Lineage for d3w01a_ (3w01 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1144404Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1144405Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1144609Protein PcrB protein homolog YerE [102046] (2 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 1144614Species Staphylococcus aureus [TaxId:418127] [194170] (2 PDB entries)
  8. 1144615Domain d3w01a_: 3w01 A: [194174]
    automated match to d1viza_
    complexed with pge

Details for d3w01a_

PDB Entry: 3w01 (more details), 1.54 Å

PDB Description: Crystal structure of PcrB complexed with PEG from Staphylococcus aureus subsp. aureus Mu3
PDB Compounds: (A:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w01a_ c.1.4.1 (A:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
agagamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmski
rryplplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevif
egyvvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqav
sehltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvki

SCOPe Domain Coordinates for d3w01a_:

Click to download the PDB-style file with coordinates for d3w01a_.
(The format of our PDB-style files is described here.)

Timeline for d3w01a_: