Lineage for d3w01b_ (3w01 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1816698Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1817023Protein PcrB protein homolog YerE [102046] (2 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 1817035Species Staphylococcus aureus [TaxId:418127] [194170] (2 PDB entries)
  8. 1817037Domain d3w01b_: 3w01 B: [194173]
    automated match to d1viza_
    complexed with pge

Details for d3w01b_

PDB Entry: 3w01 (more details), 1.54 Å

PDB Description: Crystal structure of PcrB complexed with PEG from Staphylococcus aureus subsp. aureus Mu3
PDB Compounds: (B:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w01b_:

Sequence, based on SEQRES records: (download)

>d3w01b_ c.1.4.1 (B:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
agamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirr
yplplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifeg
yvvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavse
hltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes

Sequence, based on observed residues (ATOM records): (download)

>d3w01b_ c.1.4.1 (B:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
agamydikkwrhifkldpakhisdddldaicmsqtdaimigvtednvihlmskirryplp
lvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyvvc
nadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehlte
tqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes

SCOPe Domain Coordinates for d3w01b_:

Click to download the PDB-style file with coordinates for d3w01b_.
(The format of our PDB-style files is described here.)

Timeline for d3w01b_: