SCOPe 2.05: Domain d3w01b_: 3w01 B:

Lineage for d3w01b_ (3w01 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein PcrB protein homolog YerE [102046] (2 species)
   provisional classification; it is not known whether this protein binds FMN or not

7. Species Staphylococcus aureus [TaxId:418127] [194170] (2 PDB entries)

8. Domain d3w01b_: 3w01 B: [194173]
   automated match to d1viza_
   complexed with pge

Details for d3w01b_

PDB Entry: 3w01, 1.54 Å

PDB Description: Crystal structure of PcrB complexed with PEG from Staphylococcus aureus subsp. aureus Mu3

PDB Compounds: (B:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w01b_:

Sequence, based on SEQRES records:

>d3w01b_ c.1.4.1 (B:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
agamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirr
yplplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifeg
yvvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavse
hltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes

Sequence, based on observed residues (ATOM records):

>d3w01b_ c.1.4.1 (B:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
agamydikkwrhifkldpakhisdddldaicmsqtdaimigvtednvihlmskirryplp
lvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyvvc
nadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehlte
tqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes

Timeline for d3w01b_:

• d3w01b_ first appeared in SCOPe 2.02
  
• d3w01b_ appears in SCOPe 2.04
  
• d3w01b_ is called d3w01b1 in SCOPe 2.06
  
• d3w01b_ appears in the current release, SCOPe 2.08, called d3w01b1