![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein PcrB protein homolog YerE [102046] (2 species) provisional classification; it is not known whether this protein binds FMN or not |
![]() | Species Staphylococcus aureus [TaxId:418127] [194170] (2 PDB entries) |
![]() | Domain d3w01b_: 3w01 B: [194173] automated match to d1viza_ complexed with pge |
PDB Entry: 3w01 (more details), 1.54 Å
SCOPe Domain Sequences for d3w01b_:
Sequence, based on SEQRES records: (download)
>d3w01b_ c.1.4.1 (B:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]} agamydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirr yplplvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifeg yvvcnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavse hltetqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes
>d3w01b_ c.1.4.1 (B:) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]} agamydikkwrhifkldpakhisdddldaicmsqtdaimigvtednvihlmskirryplp lvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyvvc nadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehlte tqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes
Timeline for d3w01b_: