SCOPe 2.08: Domain d3w01b1: 3w01 B:1-228

Lineage for d3w01b1 (3w01 B:1-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein PcrB protein homolog YerE [102046] (2 species)
   provisional classification; it is not known whether this protein binds FMN or not

7. Species Staphylococcus aureus [TaxId:418127] [194170] (2 PDB entries)

8. Domain d3w01b1: 3w01 B:1-228 [194173]
   Other proteins in same PDB: d3w01a2, d3w01b2
   automated match to d1viza_
   complexed with pge

Details for d3w01b1

PDB Entry: 3w01, 1.54 Å

PDB Description: Crystal structure of PcrB complexed with PEG from Staphylococcus aureus subsp. aureus Mu3

PDB Compounds: (B:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w01b1:

Sequence, based on SEQRES records:

>d3w01b1 c.1.4.1 (B:1-228) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
mydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirrypl
plvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyvv
cnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehlt
etqlfygggisseqqatemaaiadtiivgdiiykdikkalktvkikes

Sequence, based on observed residues (ATOM records):

>d3w01b1 c.1.4.1 (B:1-228) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
mydikkwrhifkldpakhisdddldaicmsqtdaimigvtednvihlmskirryplplvl
eisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyvvcnad
skvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehltetql
fygggisseqqatemaaiadtiivgdiiykdikkalktvkikes

Timeline for d3w01b1:

• d3w01b1 first appeared in SCOPe 2.02, called d3w01b_
  
• d3w01b1 appears in SCOPe 2.07