SCOPe 2.08: Domain d3w02a1: 3w02 A:1-225

Lineage for d3w02a1 (3w02 A:1-225)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein PcrB protein homolog YerE [102046] (2 species)
   provisional classification; it is not known whether this protein binds FMN or not

7. Species Staphylococcus aureus [TaxId:418127] [194170] (2 PDB entries)

8. Domain d3w02a1: 3w02 A:1-225 [194172]
   Other proteins in same PDB: d3w02a2, d3w02b2
   automated match to d1viza_
   complexed with so4

Details for d3w02a1

PDB Entry: 3w02, 2.98 Å

PDB Description: Crystal structure of PcrB complexed with SO4 from Staphylococcus aureus subsp. aureus Mu3

PDB Compounds: (A:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3w02a1:

Sequence; same for both SEQRES and ATOM records:

>d3w02a1 c.1.4.1 (A:1-225) PcrB protein homolog YerE {Staphylococcus aureus [TaxId: 418127]}
mydikkwrhifkldpakhisdddldaicmsqtdaimiggtddvtednvihlmskirrypl
plvleisniesvmpgfdfyfvptvlnstdvafhngtllealktyghsidfeevifegyvv
cnadskvakhtkantdlttedleayaqmvnhmyrlpvmyieysgiygdvskvqavsehlt
etqlfygggisseqqatemaaiadtiivgdiiykdikkalktvki

Timeline for d3w02a1:

• d3w02a1 first appeared in SCOPe 2.02, called d3w02a_
  
• d3w02a1 appears in SCOPe 2.07