Lineage for d1auwb_ (1auw B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 6535Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 6536Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (2 PDB entries)
  8. 6538Domain d1auwb_: 1auw B: [19417]

Details for d1auwb_

PDB Entry: 1auw (more details), 2.5 Å

PDB Description: h91n delta 2 crystallin from duck

SCOP Domain Sequences for d1auwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auwb_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedintanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltdsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
ytalggtakssvttqieqlrelmkkqk

SCOP Domain Coordinates for d1auwb_:

Click to download the PDB-style file with coordinates for d1auwb_.
(The format of our PDB-style files is described here.)

Timeline for d1auwb_: