Lineage for d3zbwb_ (3zbw B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890445Protein automated matches [190061] (6 species)
    not a true protein
  7. 1890582Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries)
  8. 1890587Domain d3zbwb_: 3zbw B: [194168]
    automated match to d2bwla_
    complexed with acy, so4, zn

Details for d3zbwb_

PDB Entry: 3zbw (more details), 1.8 Å

PDB Description: Crystal Structure of murine Angiogenin-3
PDB Compounds: (B:) angiogenin-3

SCOPe Domain Sequences for d3zbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zbwb_ d.5.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qdnyryikfltqhydakptgrdyrycesmmkkrkltspckevntfihdtknnikaicgen
gnpygvnfrisnsrfqvttcthkggsprppcqynafkdfryiviacedgwpvhfdesfis
p

SCOPe Domain Coordinates for d3zbwb_:

Click to download the PDB-style file with coordinates for d3zbwb_.
(The format of our PDB-style files is described here.)

Timeline for d3zbwb_: