| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Burkholderia vietnamiensis [TaxId:269482] [194164] (2 PDB entries) |
| Domain d4i1ub1: 4i1u B:1-201 [194165] Other proteins in same PDB: d4i1ua2, d4i1ub2 automated match to d1vhta_ complexed with cl, edo, so4 |
PDB Entry: 4i1u (more details), 2.05 Å
SCOPe Domain Sequences for d4i1ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1ub1 c.37.1.0 (B:1-201) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
myaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpafvaa
dgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllvesrnw
karcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivndaatp
dalavqvdalhqrylafaaak
Timeline for d4i1ub1: