Lineage for d3uwaa1 (3uwa A:26-148)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607146Species Synechococcus phage [TaxId:445686] [194160] (2 PDB entries)
  8. 2607147Domain d3uwaa1: 3uwa A:26-148 [194162]
    Other proteins in same PDB: d3uwaa2
    automated match to d1lmeb_
    complexed with mrd, zn

Details for d3uwaa1

PDB Entry: 3uwa (more details), 1.95 Å

PDB Description: Crystal structure of a probable peptide deformylase from synechococcus phage S-SSM7
PDB Compounds: (A:) RIIA-RIIB membrane-associated protein

SCOPe Domain Sequences for d3uwaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uwaa1 d.167.1.0 (A:26-148) automated matches {Synechococcus phage [TaxId: 445686]}
mselydqmceamwasdgiglaapqvginkrvivvdetteehgkyahlmvnpkitwkseek
vlfdegclsvpdqngevlrpksikvtfqnkdgkykkwkldglaarvvqheidhlegilfv
dyf

SCOPe Domain Coordinates for d3uwaa1:

Click to download the PDB-style file with coordinates for d3uwaa1.
(The format of our PDB-style files is described here.)

Timeline for d3uwaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uwaa2