SCOPe 2.02: Domain d3uwba_: 3uwb A:

Lineage for d3uwba_ (3uwb A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (4 species)
   not a true protein

7. Species Synechococcus phage [TaxId:445686] [194160] (2 PDB entries)

8. Domain d3uwba_: 3uwb A: [194161]
   automated match to d1lmeb_
   complexed with bb2, cl, edo, zn

Details for d3uwba_

PDB Entry: 3uwb, 1.7 Å

PDB Description: crystal structure of a probable peptide deformylase from strucynechococcus phage s-ssm7 in complex with actinonin

PDB Compounds: (A:) RIIA-RIIB membrane-associated protein

SCOPe Domain Sequences for d3uwba_:

Sequence; same for both SEQRES and ATOM records:

>d3uwba_ d.167.1.0 (A:) automated matches {Synechococcus phage [TaxId: 445686]}
slkiktigdrclrqkseevefdkkemselydqmceamwasdgiglaapqvginkrvivvd
etteehgkyahlmvnpkitwkseekvlfdegclsvpdqngevlrpksikvtfqnkdgkyk
kwkldglaarvvqheidhlegilfvdyfn

Timeline for d3uwba_:

• d3uwba_ is new in SCOPe 2.02-stable
  
• d3uwba_ appears in SCOPe 2.03
  
• d3uwba_ appears in the current release, SCOPe 2.08, called d3uwba1