SCOPe 2.08: Domain d3uwba1: 3uwb A:26-149

Lineage for d3uwba1 (3uwb A:26-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Synechococcus phage [TaxId:445686] [194160] (2 PDB entries)

8. Domain d3uwba1: 3uwb A:26-149 [194161]
   Other proteins in same PDB: d3uwba2
   automated match to d1lmeb_
   complexed with bb2, cl, edo, zn

Details for d3uwba1

PDB Entry: 3uwb, 1.7 Å

PDB Description: crystal structure of a probable peptide deformylase from strucynechococcus phage s-ssm7 in complex with actinonin

PDB Compounds: (A:) RIIA-RIIB membrane-associated protein

SCOPe Domain Sequences for d3uwba1:

Sequence; same for both SEQRES and ATOM records:

>d3uwba1 d.167.1.0 (A:26-149) automated matches {Synechococcus phage [TaxId: 445686]}
mselydqmceamwasdgiglaapqvginkrvivvdetteehgkyahlmvnpkitwkseek
vlfdegclsvpdqngevlrpksikvtfqnkdgkykkwkldglaarvvqheidhlegilfv
dyfn

Timeline for d3uwba1:

• d3uwba1 first appeared in SCOPe 2.02, called d3uwba_
  
• d3uwba1 appears in SCOPe 2.07