SCOPe 2.08: Domain d4b55a_: 4b55 A:

Lineage for d4b55a_ (4b55 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein automated matches [190090] (5 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:1781] [188307] (4 PDB entries)

8. Domain d4b55a_: 4b55 A: [194157]
   automated match to d2vfba_
   complexed with p18

Details for d4b55a_

PDB Entry: 4b55, 2.7 Å

PDB Description: Crystal Structure of the Covalent Adduct Formed between Mycobacterium marinum Aryalamine N-acetyltransferase and Phenyl vinyl ketone a derivative of Piperidinols

PDB Compounds: (A:) Arylamine N-acetyltransferase Nat

SCOPe Domain Sequences for d4b55a_:

Sequence; same for both SEQRES and ATOM records:

>d4b55a_ d.3.1.5 (A:) automated matches {Mycobacterium marinum [TaxId: 1781]}
ldltgyldrinyrgatdptldvlrdlvsahtgaiafenldplmgvpvddlsaealadklv
drrrggycyehngligyvlaelgyrvrrlagrvvwlappdaptpaqthtvlavtfpgcqg
pylvdvgfggmtptaplrletgtvqqtalepyrlddrgdglvlqamvrdewqalyefstl
trpqvdlrvgswfvsthptshfvtglmaatvaddarwnlmgrnlaihrrggtekilleda
aavvdtlgdrfginvadvgergrlearidkvcf

Timeline for d4b55a_:

• d4b55a_ first appeared in SCOPe 2.02
  
• d4b55a_ appears in SCOPe 2.07