| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.102: Regulatory factor Nef [55670] (1 superfamily) alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) ![]() |
| Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins) automatically mapped to Pfam PF00469 |
| Protein automated matches [191288] (2 species) not a true protein |
| Species Human immunodeficiency virus type 1 [TaxId:11686] [194153] (1 PDB entry) |
| Domain d4d8dd_: 4d8d D: [194155] Other proteins in same PDB: d4d8da_, d4d8dc_ automated match to d1avzb_ complexed with gol |
PDB Entry: 4d8d (more details), 2.52 Å
SCOPe Domain Sequences for d4d8dd_:
Sequence, based on SEQRES records: (download)
>d4d8dd_ d.102.1.1 (D:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11686]}
vtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytp
gpgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrl
afhhvarelhpeyfk
>d4d8dd_ d.102.1.1 (D:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11686]}
vtpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytp
gpgvrypltfgwcyklvpvevlewrfdsrlafhhvarelhpeyfk
Timeline for d4d8dd_: