Lineage for d1aosb_ (1aos B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 protein domains)
  6. 6535Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 6545Species Human (Homo sapiens) [TaxId:9606] [48565] (1 PDB entry)
  8. 6547Domain d1aosb_: 1aos B: [19415]

Details for d1aosb_

PDB Entry: 1aos (more details), 4.2 Å

PDB Description: human argininosuccinate lyase

SCOP Domain Sequences for d1aosb_:

Sequence, based on SEQRES records: (download)

>d1aosb_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens)}
imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvaeewaqgtf
klnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwel
irtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlpl
gsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaed
lilyctkefsfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglps
tynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvr
kgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqyga
lggtarssvdwqirqvrallqaq

Sequence, based on observed residues (ATOM records): (download)

>d1aosb_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens)}
imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvklnsndedi
htanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwelirtmvdrae
aerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlplgsgaiagnp
lgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaedlilyctkef
sfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglpstynkdlqed
keavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvrkgmpfrqah
easgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqygalggtarssv
dwqirqvrallqaq

SCOP Domain Coordinates for d1aosb_:

Click to download the PDB-style file with coordinates for d1aosb_.
(The format of our PDB-style files is described here.)

Timeline for d1aosb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aosa_