Lineage for d4fjsa_ (4fjs A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529345Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2529346Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2529347Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 2529380Protein automated matches [194139] (3 species)
    not a true protein
  7. 2529381Species Escherichia coli [TaxId:316385] [194144] (2 PDB entries)
  8. 2529384Domain d4fjsa_: 4fjs A: [194148]
    automated match to d1xrha_

Details for d4fjsa_

PDB Entry: 4fjs (more details), 2.13 Å

PDB Description: crystal structure of ureidoglycolate dehydrogenase enzyme in apo form
PDB Compounds: (A:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d4fjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjsa_ c.122.1.1 (A:) automated matches {Escherichia coli [TaxId: 316385]}
mkisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskgg
tnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsgai
syfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattvq
awgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvll
glpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgfn
qvyypgqdqdikqrkaavegieivddiyqylisdaly

SCOPe Domain Coordinates for d4fjsa_:

Click to download the PDB-style file with coordinates for d4fjsa_.
(The format of our PDB-style files is described here.)

Timeline for d4fjsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fjsb_