| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily) core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest |
Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) ![]() topological similarity to the domain 2 of TM1585 automatically mapped to Pfam PF02615 |
| Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins) Pfam PF02615; type II malate/L-lactate dehydrogenase; |
| Protein automated matches [194139] (3 species) not a true protein |
| Species Escherichia coli [TaxId:316385] [194144] (2 PDB entries) |
| Domain d4fjua_: 4fju A: [194145] automated match to d1xrha_ complexed with glv, nai |
PDB Entry: 4fju (more details), 1.77 Å
SCOPe Domain Sequences for d4fjua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fjua_ c.122.1.1 (A:) automated matches {Escherichia coli [TaxId: 316385]}
mkisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskgg
tnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsgai
syfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattvq
awgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvll
glpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgfn
qvyypgqdqdikqrkaavegieivddiyqylisdalyn
Timeline for d4fjua_: