SCOPe 2.05: Domain d4fjua_: 4fju A:

Lineage for d4fjua_ (4fju A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
   core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest

4. Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families)
   topological similarity to the domain 2 of TM1585
   automatically mapped to Pfam PF02615

5. Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
   Pfam PF02615; type II malate/L-lactate dehydrogenase;

6. Protein automated matches [194139] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:316385] [194144] (2 PDB entries)

8. Domain d4fjua_: 4fju A: [194145]
   automated match to d1xrha_
   complexed with glv, nai

Details for d4fjua_

PDB Entry: 4fju, 1.77 Å

PDB Description: crystal structure of ureidoglycolate dehydrogenase in ternary complex with nadh and glyoxylate

PDB Compounds: (A:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d4fjua_:

Sequence; same for both SEQRES and ATOM records:

>d4fjua_ c.122.1.1 (A:) automated matches {Escherichia coli [TaxId: 316385]}
mkisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskgg
tnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsgai
syfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattvq
awgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvll
glpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgfn
qvyypgqdqdikqrkaavegieivddiyqylisdalyn

Timeline for d4fjua_:

• d4fjua_ first appeared in SCOPe 2.02
  
• d4fjua_ appears in SCOPe 2.04
  
• d4fjua_ appears in SCOPe 2.06
  
• d4fjua_ appears in the current release, SCOPe 2.08