Lineage for d1aosa_ (1aos A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156518Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 156519Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 156520Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 156534Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 156554Species Human (Homo sapiens) [TaxId:9606] [48565] (2 PDB entries)
  8. 156557Domain d1aosa_: 1aos A: [19414]

Details for d1aosa_

PDB Entry: 1aos (more details), 4.2 Å

PDB Description: human argininosuccinate lyase

SCOP Domain Sequences for d1aosa_:

Sequence, based on SEQRES records: (download)

>d1aosa_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens)}
imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvaeewaqgtf
klnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwel
irtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlpl
gsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaed
lilyctkefsfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglps
tynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvr
kgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqyga
lggtarssvdwqirqvrallqaq

Sequence, based on observed residues (ATOM records): (download)

>d1aosa_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens)}
imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvklnsndedi
htanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwelirtmvdrae
aerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlplgsgaiagnp
lgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaedlilyctkef
sfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglpstynkdlqed
keavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvrkgmpfrqah
easgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqygalggtarssv
dwqirqvrallqaq

SCOP Domain Coordinates for d1aosa_:

Click to download the PDB-style file with coordinates for d1aosa_.
(The format of our PDB-style files is described here.)

Timeline for d1aosa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aosb_