SCOPe 2.08: Domain d4i6la1: 4i6l A:45-271

Lineage for d4i6la1 (4i6l A:45-271)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)

8. Domain d4i6la1: 4i6l A:45-271 [194133]
   Other proteins in same PDB: d4i6la2, d4i6lb1, d4i6lb2
   automated match to d2zfya_

Details for d4i6la1

PDB Entry: 4i6l, 2.49 Å

PDB Description: Crystal structure of OTUB1 in complex with ubiquitin variant

PDB Compounds: (A:) Ubiquitin thioesterase OTUB1

SCOPe Domain Sequences for d4i6la1:

Sequence, based on SEQRES records:

>d4i6la1 d.3.1.0 (A:45-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgnsfyrafgfshleal
lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd
qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala
qalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk

Sequence, based on observed residues (ATOM records):

>d4i6la1 d.3.1.0 (A:45-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeydniyqqkikdlhkkysyirktrpdgnsfyrafgfshlealldd
skelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqst
sdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqal
svsiqveymphifpegsepkvyllyrpghydilyk

Timeline for d4i6la1:

• d4i6la1 first appeared in SCOPe 2.02, called d4i6la_
  
• d4i6la1 appears in SCOPe 2.07