Lineage for d4i6la1 (4i6l A:45-271)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927669Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)
  8. 2927705Domain d4i6la1: 4i6l A:45-271 [194133]
    Other proteins in same PDB: d4i6la2, d4i6lb1, d4i6lb2
    automated match to d2zfya_

Details for d4i6la1

PDB Entry: 4i6l (more details), 2.49 Å

PDB Description: Crystal structure of OTUB1 in complex with ubiquitin variant
PDB Compounds: (A:) Ubiquitin thioesterase OTUB1

SCOPe Domain Sequences for d4i6la1:

Sequence, based on SEQRES records: (download)

>d4i6la1 d.3.1.0 (A:45-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgnsfyrafgfshleal
lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd
qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala
qalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk

Sequence, based on observed residues (ATOM records): (download)

>d4i6la1 d.3.1.0 (A:45-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeydniyqqkikdlhkkysyirktrpdgnsfyrafgfshlealldd
skelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqst
sdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqal
svsiqveymphifpegsepkvyllyrpghydilyk

SCOPe Domain Coordinates for d4i6la1:

Click to download the PDB-style file with coordinates for d4i6la1.
(The format of our PDB-style files is described here.)

Timeline for d4i6la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6la2