Lineage for d4ib2b_ (4ib2 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880881Species Ruminococcus gnavus [TaxId:411470] [194126] (1 PDB entry)
  8. 1880883Domain d4ib2b_: 4ib2 B: [194130]
    automated match to d1xs5a_
    complexed with cl, gol, met

Details for d4ib2b_

PDB Entry: 4ib2 (more details), 1.76 Å

PDB Description: crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
PDB Compounds: (B:) Putative lipoprotein

SCOPe Domain Sequences for d4ib2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ib2b_ c.94.1.0 (B:) automated matches {Ruminococcus gnavus [TaxId: 411470]}
aktikvaasatphaeileqaksilkkegyqlevtvfddyvqpnevvesgefdanyfqhvp
ylesfneekgthlvdagdihyepfgiypgtkksldeisegdkiavpndttnearallllq
dngiitlkdgaglnatvndieenpynveiveleaaqvarvtgetayvvlngnyaleagys
vakdalayeksdseaaktyvniiavkegnekeekiqalvkalksdeikeyiektydgavi
pfe

SCOPe Domain Coordinates for d4ib2b_:

Click to download the PDB-style file with coordinates for d4ib2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ib2b_: