Lineage for d1yfma_ (1yfm A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648513Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 648514Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 648515Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 648587Protein Fumarase [48561] (3 species)
  7. 648588Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48563] (1 PDB entry)
  8. 648589Domain d1yfma_: 1yfm A: [19413]
    mutant

Details for d1yfma_

PDB Entry: 1yfm (more details), 2.6 Å

PDB Description: recombinant yeast fumarase
PDB Compounds: (A:) Fumarase

SCOP Domain Sequences for d1yfma_:

Sequence, based on SEQRES records: (download)

>d1yfma_ a.127.1.1 (A:) Fumarase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieilgg
kigskqvhpnnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhi
vkigrthlqdatpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpg
fdvkiaeqisketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsg
prcgyhelmlpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvf
kpvmianllnsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaa
skvaknahkkgitlkesalelgvltekefdewvvpehml

Sequence, based on observed residues (ATOM records): (download)

>d1yfma_ a.127.1.1 (A:) Fumarase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieivhp
nnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhivkigrthlq
datpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpgfdvkiaeqi
sketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsgprcgyhelm
lpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvfkpvmianll
nsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaaskvaknahk
kgitlkesalelgvltekefdewvvpehml

SCOP Domain Coordinates for d1yfma_:

Click to download the PDB-style file with coordinates for d1yfma_.
(The format of our PDB-style files is described here.)

Timeline for d1yfma_: