Lineage for d1yfm__ (1yfm -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217746Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 217747Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 217748Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 217792Protein Fumarase [48561] (2 species)
  7. 217793Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48563] (1 PDB entry)
  8. 217794Domain d1yfm__: 1yfm - [19413]
    mutant

Details for d1yfm__

PDB Entry: 1yfm (more details), 2.6 Å

PDB Description: recombinant yeast fumarase

SCOP Domain Sequences for d1yfm__:

Sequence, based on SEQRES records: (download)

>d1yfm__ a.127.1.1 (-) Fumarase {Baker's yeast (Saccharomyces cerevisiae)}
sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieilgg
kigskqvhpnnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhi
vkigrthlqdatpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpg
fdvkiaeqisketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsg
prcgyhelmlpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvf
kpvmianllnsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaa
skvaknahkkgitlkesalelgvltekefdewvvpehml

Sequence, based on observed residues (ATOM records): (download)

>d1yfm__ a.127.1.1 (-) Fumarase {Baker's yeast (Saccharomyces cerevisiae)}
sfrtetdafgeihvpadkywgaqtqrsfqnfkiggarermplplvhafgvlkksaaivne
slggldpkiskaiqqaadevasgklddhfplvvfqtgsgtqsnmnanevisnraieivhp
nnhcnqsqssndtfptvmhiaaslqiqnelipeltnlknaleakskefdhivkigrthlq
datpltlgqefsgyvqqvengiqrvahslktlsflaqggtavgtglntkpgfdvkiaeqi
sketglkfqtapnrfealaahdaivecsgalntlacslfkiaqdirylgsgprcgyhelm
lpenepgssimpgkvnptqnealtqvcvqvmgnnaaitfagsqgqfelnvfkpvmianll
nsirlitdaaysfrvhcvegikaneprihelltkslmlvtalnpkigydaaskvaknahk
kgitlkesalelgvltekefdewvvpehml

SCOP Domain Coordinates for d1yfm__:

Click to download the PDB-style file with coordinates for d1yfm__.
(The format of our PDB-style files is described here.)

Timeline for d1yfm__: