Lineage for d4ijba_ (4ijb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079697Protein automated matches [190053] (9 species)
    not a true protein
  7. 2079698Species Artificial gene [TaxId:32630] [188991] (9 PDB entries)
  8. 2079699Domain d4ijba_: 4ijb A: [194124]
    automated match to d1a53a_

Details for d4ijba_

PDB Entry: 4ijb (more details), 1.74 Å

PDB Description: Crystal Structure of Engineered Protein, Northeast Structural Genomics Consortium Target OR288
PDB Compounds: (A:) Engineered Protein OR288

SCOPe Domain Sequences for d4ijba_:

Sequence, based on SEQRES records: (download)

>d4ijba_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiialymrkspsgld
verdpieyakfmeryavglsivteekyfngsyetlrkiassvsipilmndfivkesqidd
aynlgadtvalkvkiltereleslleyarsygmeplieindendldialrigarfigiws
qdnetleinkenqrklismipsnvvkvagggiserneieelrklgvnafligeslmrnpe
kikelie

Sequence, based on observed residues (ATOM records): (download)

>d4ijba_ c.1.2.4 (A:) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiialymrkspsgld
verdpieyakfmeryavglsivteekyfngsyetlrkiassvsipilmndfivkesqidd
aynlgadtvalkvkiltereleslleyarsygmeplieindendldialrigarfigiws
etleinkenqrklismipsnvvkvagggiserneieelrklgvnafligeslmrnpekik
elie

SCOPe Domain Coordinates for d4ijba_:

Click to download the PDB-style file with coordinates for d4ijba_.
(The format of our PDB-style files is described here.)

Timeline for d4ijba_: