Lineage for d3vndf_ (3vnd F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079686Species Shewanella frigidimarina [TaxId:56812] [224873] (1 PDB entry)
  8. 2079692Domain d3vndf_: 3vnd F: [194120]
    automated match to d3nava_
    complexed with pe8, so4

Details for d3vndf_

PDB Entry: 3vnd (more details), 2.6 Å

PDB Description: Crystal structure of tryptophan synthase alpha-subunit from the psychrophile Shewanella frigidimarina K14-2
PDB Compounds: (F:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d3vndf_:

Sequence, based on SEQRES records: (download)

>d3vndf_ c.1.2.4 (F:) Trp synthase alpha-subunit {Shewanella frigidimarina [TaxId: 56812]}
msnryqakfaalkaqdkgafvpfvtigdpspelslkiiqtlvdngadalelgfpfsdpla
dgpviqganlrslaagttssdcfdiitkvraqhpdmpiglllyanlvfangidefytkaq
aagvdsvliadvpveesapfskaakahgiapifiappnadadtlkmvseqgegytyllsr
agvtgteskagepieniltqlaefnapppllgfgiaepeqvraaikagaagaisgsavvk
iieahqhdeatllaklaefttamkaat

Sequence, based on observed residues (ATOM records): (download)

>d3vndf_ c.1.2.4 (F:) Trp synthase alpha-subunit {Shewanella frigidimarina [TaxId: 56812]}
msnryqakfaalkaqdkgafvpfvtigdpspelslkiiqtlvdngadalelgfpfsdpla
dgpviqganlrslaagttssdcfdiitkvraqhpdmpiglllyanlvfangidefytkaq
aagvdsvliadvpveesapfskaakahgiapifiappnadadtlkmvseqgegytyllsr
agvtpieniltqlaefnapppllgfgiaepeqvraaikagaagaisgsavvkiieahqhd
eatllaklaefttamkaat

SCOPe Domain Coordinates for d3vndf_:

Click to download the PDB-style file with coordinates for d3vndf_.
(The format of our PDB-style files is described here.)

Timeline for d3vndf_: