Lineage for d1fuob_ (1fuo B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 6550Protein Fumarase [48561] (2 species)
  7. 6553Species Escherichia coli [TaxId:562] [48562] (5 PDB entries)
  8. 6563Domain d1fuob_: 1fuo B: [19412]

Details for d1fuob_

PDB Entry: 1fuo (more details), 2.7 Å

PDB Description: fumarase c with bound citrate

SCOP Domain Sequences for d1fuob_:

Sequence, based on SEQRES records: (download)

>d1fuob_ a.127.1.1 (B:) Fumarase {Escherichia coli}
mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
gprcgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnv
frpmvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydk
aaeiakkahkegltlkaaalalgylseaefdswvrpeqm

Sequence, based on observed residues (ATOM records): (download)

>d1fuob_ a.127.1.1 (B:) Fumarase {Escherichia coli}
mntvrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvne
dlgllseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellgg
vrgmerkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafad
ivkigrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthp
eyarrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlas
gprcgigeisipenepmpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrpm
vihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaaei
akkahkegltlkaaalalgylseaefdswvrpeqm

SCOP Domain Coordinates for d1fuob_:

Click to download the PDB-style file with coordinates for d1fuob_.
(The format of our PDB-style files is described here.)

Timeline for d1fuob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fuoa_