Lineage for d4ax7c_ (4ax7 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833669Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 1833670Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 1833714Protein automated matches [191253] (6 species)
    not a true protein
  7. 1833728Species Trichoderma reesei [TaxId:51453] [194094] (2 PDB entries)
  8. 1833731Domain d4ax7c_: 4ax7 C: [194098]
    automated match to d1cb2a_
    complexed with 4mu, man, nag; mutant

Details for d4ax7c_

PDB Entry: 4ax7 (more details), 1.7 Å

PDB Description: hypocrea jecorina cel6a d221a mutant soaked with 4-methylumbelliferyl- beta-d-cellobioside
PDB Compounds: (C:) exoglucanase 2

SCOPe Domain Sequences for d4ax7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ax7c_ c.6.1.1 (C:) automated matches {Trichoderma reesei [TaxId: 51453]}
tatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldktpl
meqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidtirq
ivveysdirtllviepaslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamylda
ghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgnavy
neklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsantg
dslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltnanp
sfl

SCOPe Domain Coordinates for d4ax7c_:

Click to download the PDB-style file with coordinates for d4ax7c_.
(The format of our PDB-style files is described here.)

Timeline for d4ax7c_: