SCOPe 2.06: Domain d4b3wa_: 4b3w A:

Lineage for d4b3wa_ (4b3w A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188371] (6 PDB entries)

8. Domain d4b3wa_: 4b3w A: [194093]
   automated match to d1ut0b_
   complexed with act, cyn, fc6, hem; mutant

Details for d4b3wa_

PDB Entry: 4b3w, 2.8 Å

PDB Description: Crystal structure of human cytoglobin H(E7)Q mutant

PDB Compounds: (A:) cytoglobin

SCOPe Domain Sequences for d4b3wa_:

Sequence; same for both SEQRES and ATOM records:

>d4b3wa_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkqasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

Timeline for d4b3wa_:

• d4b3wa_ first appeared in SCOPe 2.02
  
• d4b3wa_ appears in SCOPe 2.05
  
• d4b3wa_ appears in SCOPe 2.07
  
• d4b3wa_ appears in the current release, SCOPe 2.08