Lineage for d4e3ta_ (4e3t A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442120Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 2442239Protein automated matches [190258] (3 species)
    not a true protein
  7. 2442243Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)
  8. 2442244Domain d4e3ta_: 4e3t A: [194090]
    automated match to d1qw7a_
    complexed with hln, zn

Details for d4e3ta_

PDB Entry: 4e3t (more details), 1.65 Å

PDB Description: Round 18 Arylesterase Variant of Phosphotriesterase with Bound Transition State Analog
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d4e3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3ta_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]}
rintvrgpitisevgftlthehicgssagflrawpeffgsrealvekavrglrraraagv
rtivdvstfdlgrdvrllaevsraadvhivaatgvwldpplsirmrsveeltqfflreiq
ygiedtgiragiikvaitgkvtpfqelvlraaaraslatgvpvithtagsqrggeqqaai
feseglspsrvcighsdetddlsyltalaargyligldriphsaiglednasatafmgsr
swqtrallikalidqgymkqilvsndwlfgissyvtnfmdvmdsvnpdgmafiplrvipf
lrekgipqetlagitvtnparflsptl

SCOPe Domain Coordinates for d4e3ta_:

Click to download the PDB-style file with coordinates for d4e3ta_.
(The format of our PDB-style files is described here.)

Timeline for d4e3ta_: