Lineage for d2fusa_ (2fus A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648513Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 648514Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 648515Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 648587Protein Fumarase [48561] (3 species)
  7. 648590Species Escherichia coli [TaxId:562] [48562] (7 PDB entries)
  8. 648598Domain d2fusa_: 2fus A: [19409]

Details for d2fusa_

PDB Entry: 2fus (more details), 2.3 Å

PDB Description: mutations of fumarase that distinguish between the active site and a nearby dicarboxylic acid binding site
PDB Compounds: (A:) fumarase c

SCOP Domain Sequences for d2fusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fusa_ a.127.1.1 (A:) Fumarase {Escherichia coli [TaxId: 562]}
vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
merkvnpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
iakkahkegltlkaaalalgylseaefdswvrpeqm

SCOP Domain Coordinates for d2fusa_:

Click to download the PDB-style file with coordinates for d2fusa_.
(The format of our PDB-style files is described here.)

Timeline for d2fusa_: