Lineage for d4f60a_ (4f60 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900319Protein automated matches [190880] (5 species)
    not a true protein
  7. 2900325Species Rhodococcus rhodochrous [TaxId:1829] [189127] (16 PDB entries)
  8. 2900329Domain d4f60a_: 4f60 A: [194086]
    automated match to d3fwha_
    complexed with f; mutant

Details for d4f60a_

PDB Entry: 4f60 (more details), 1.45 Å

PDB Description: Crystal structure of Rhodococcus rhodochrous haloalkane dehalogenase mutant (T148L, G171Q, A172V, C176F).
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4f60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f60a_ c.69.1.8 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdewpefarelfqafrtadvgreliidqnafieqvlpkfvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

SCOPe Domain Coordinates for d4f60a_:

Click to download the PDB-style file with coordinates for d4f60a_.
(The format of our PDB-style files is described here.)

Timeline for d4f60a_: