Class g: Small proteins [56992] (98 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
Protein automated matches [193184] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries) |
Domain d4fkda1: 4fkd A:10-59 [194084] Other proteins in same PDB: d4fkda2, d4fkda3 automated match to d1ptqa_ complexed with zn |
PDB Entry: 4fkd (more details), 1.63 Å
SCOPe Domain Sequences for d4fkda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fkda1 g.49.1.1 (A:10-59) automated matches {Mouse (Mus musculus) [TaxId: 10090]} hrfkvynyksptfcehcgtllwglarqglkcdacgmnvhhrcqtkvanlc
Timeline for d4fkda1: