Lineage for d4fkda1 (4fkd A:10-59)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037803Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 3037826Protein automated matches [193184] (2 species)
    not a true protein
  7. 3037829Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)
  8. 3037830Domain d4fkda1: 4fkd A:10-59 [194084]
    Other proteins in same PDB: d4fkda2, d4fkda3
    automated match to d1ptqa_
    complexed with zn

Details for d4fkda1

PDB Entry: 4fkd (more details), 1.63 Å

PDB Description: Identification of the Activator Binding Residues in the Second Cysteine-Rich Regulatory Domain of Protein Kinase C Theta
PDB Compounds: (A:) Protein kinase C theta type

SCOPe Domain Sequences for d4fkda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fkda1 g.49.1.1 (A:10-59) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvynyksptfcehcgtllwglarqglkcdacgmnvhhrcqtkvanlc

SCOPe Domain Coordinates for d4fkda1:

Click to download the PDB-style file with coordinates for d4fkda1.
(The format of our PDB-style files is described here.)

Timeline for d4fkda1: