Lineage for d4h9lm_ (4h9l M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027382Protein M (medium) subunit [81481] (4 species)
  7. 3027383Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
    Uniprot P02953
  8. 3027445Domain d4h9lm_: 4h9l M: [194078]
    Other proteins in same PDB: d4h9lh1, d4h9lh2, d4h9ll_
    automated match to d2j8dm_
    complexed with bcl, bph, fe, spo, u10

Details for d4h9lm_

PDB Entry: 4h9l (more details), 2.77 Å

PDB Description: bacterial photosynthetic reaction center from rhodobacter sphaeroides with ile m265 replaced with ser
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d4h9lm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9lm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegshrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

SCOPe Domain Coordinates for d4h9lm_:

Click to download the PDB-style file with coordinates for d4h9lm_.
(The format of our PDB-style files is described here.)

Timeline for d4h9lm_: