Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein automated matches [190393] (12 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [194072] (1 PDB entry) |
Domain d4huta_: 4hut A: [194074] automated match to d1g64b_ complexed with atp, b12, edo, mg |
PDB Entry: 4hut (more details), 1.95 Å
SCOPe Domain Sequences for d4huta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huta_ c.37.1.11 (A:) automated matches {Salmonella enterica [TaxId: 99287]} yqqrqqkvkdrvdarvaqaqeergiiivftgngkgkttaafgtaaravghgknvgvvqfi kgtwpngernllephgvefqvmatgftwetqnreadtaacmavwqhgkrmladplldmvv ldeltymvaydylpleevisalnarpghqtviitgrgchrdildladtvselrpvkhafd agvkaqmgidy
Timeline for d4huta_: