Lineage for d4huta_ (4hut A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869998Protein automated matches [190393] (12 species)
    not a true protein
  7. 2870108Species Salmonella enterica [TaxId:99287] [194072] (1 PDB entry)
  8. 2870109Domain d4huta_: 4hut A: [194074]
    automated match to d1g64b_
    complexed with atp, b12, edo, mg

Details for d4huta_

PDB Entry: 4hut (more details), 1.95 Å

PDB Description: Structure of ATP:co(I)rrinoid adenosyltransferase (CobA) from Salmonella enterica in complex with four and five-coordinate cob(II)alamin and ATP
PDB Compounds: (A:) Cob(I)yrinic acid a,c-diamide adenosyltransferase

SCOPe Domain Sequences for d4huta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huta_ c.37.1.11 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
yqqrqqkvkdrvdarvaqaqeergiiivftgngkgkttaafgtaaravghgknvgvvqfi
kgtwpngernllephgvefqvmatgftwetqnreadtaacmavwqhgkrmladplldmvv
ldeltymvaydylpleevisalnarpghqtviitgrgchrdildladtvselrpvkhafd
agvkaqmgidy

SCOPe Domain Coordinates for d4huta_:

Click to download the PDB-style file with coordinates for d4huta_.
(The format of our PDB-style files is described here.)

Timeline for d4huta_: