SCOPe 2.06: Domain d3vnwa_: 3vnw A:

Lineage for d3vnwa_ (3vnw A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c552 [46636] (6 species)

7. Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
   Uniprot P04164

8. Domain d3vnwa_: 3vnw A: [194071]
   automated match to d1c52a_
   complexed with hem

Details for d3vnwa_

PDB Entry: 3vnw, 1.97 Å

PDB Description: Crystal structure of cytochrome c552 from Thermus thermophilus at pH 5.44

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3vnwa_:

Sequence; same for both SEQRES and ATOM records:

>d3vnwa_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

Timeline for d3vnwa_:

• d3vnwa_ first appeared in SCOPe 2.02
  
• d3vnwa_ appears in SCOPe 2.05
  
• d3vnwa_ appears in SCOPe 2.07
  
• d3vnwa_ appears in the current release, SCOPe 2.08