Lineage for d3vnwa_ (3vnw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690913Protein Cytochrome c552 [46636] (6 species)
  7. 2690975Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
    Uniprot P04164
  8. 2690980Domain d3vnwa_: 3vnw A: [194071]
    automated match to d1c52a_
    complexed with hem

Details for d3vnwa_

PDB Entry: 3vnw (more details), 1.97 Å

PDB Description: Crystal structure of cytochrome c552 from Thermus thermophilus at pH 5.44
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3vnwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vnwa_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

SCOPe Domain Coordinates for d3vnwa_:

Click to download the PDB-style file with coordinates for d3vnwa_.
(The format of our PDB-style files is described here.)

Timeline for d3vnwa_: